• DRAMP ID

    • DRAMP12818
    • Sequence

    • NGYRNIKYCFIDTDCPRSMCHYPEIVRCVDQCKCVRIMP
    • Sequence Length

    • 39
    • Sequence Name

    • Sequence 899 from Patent US 20120157374
    • Source

    • Synthetic construct
    • Activity

    • Antimicrobial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2012-6-21
    • Patent Title

    • Nodule specific medicago peptides having antimicrobial activity and pharmaceutical compositions containging the same.
    • Abstract

    • The present invention relates to the use of at least one peptide originated from Medicago truncatula nodules, including the SEQ IDs NO: 1-463 or at least one peptide having a sequence derived from the SEQ IDs NO: 1-463 by deletion of about 9 to about 44 contiguous amino acids, from the N-terminal part of the peptide, in particular peptides having the SEQ IDS NO: 464 to 925, for the preparation of a drug intended for the treatment of human, animal or plant diseases induced by microorganisms, wherein the peptides have a broad-spectrum and fast antibiotic activity, in particular killing of the bacteria within 1 to 3 hours.