-
-
Sequence
- GFFKKAWRKVKHAGRRVLKKGVGRHYVNNWLK
-
-
Sequence Name
- Sequence 6 from Patent US 10464975
-
-
-
-
Patent Type
- Granted Patent
-
Publication Date
- 2019-11-5
-
Family Info
-
CA2989311A1, WO2017004591A2, US20170015716A1, WO2017004591A3, AU2016287754A1
, IL256395D0, KR20180022971A, MX2017016251A, EP3317294A2, CN108026146A
, BR
-
Patent Title
- Stabilized Anti-microbial Peptides
-
Abstract
- The present invention provides methods of designing and making structurally stabilized anti-microbial peptides for the prophylaxis and treatment of infection. Methods are also disclosed for designing stabilized anti-microbial peptides that are selectively lytic/cytotoxic to bacteria, allowing for internal use of anti-microbial peptides without mammalian membrane disruption and cytotoxicity.