Sequence Information

    • DRAMP ID

    • DRAMP18172

    • Name

    • Bacteriocin OR-7

    • Sequence

    • KTYYGTNGVHCTKNSLWGKVRLKNMKYDQNTTYMGRLQDILLGWATGAFGKTFH

    • Description

    • Lactobacillus salivarius NRRL B-30514

    • Activity

    • Antibacterial

    • Target Organism

      • No MICs found on DRAMP database

    • Reference

      • Isolation of a Lactobacillus salivarius Strain and Purification of Its Bacteriocin, Which Is Inhibitory to Campylobacter jejuni in the Chicken Gastrointestinal System. (PMID: 16940109)

Clinical Information

    • Medical use

    • Gastrointestinal tract infections; Campylobacter infection (Chicken model; In-vivo)

    • Company

    • Unknown

    • Stage of Development

    • Preclinical

    • Comments

    • No more comments

    • Clinical Trials