• DRAMP ID

    • DRAMP00022
    • Peptide Name

    • Staphylococcin C55alpha (SacAalpha; chain alpha of Staphylococcin C55; Bacteriocin)
    • Source

    • Staphylococcus aureus C55 (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • Not found
    • Sequence

    • CSTNTFSLSDYWGNKGNWCTATHECMSWCK
    • Sequence Length

    • 30
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus and Micrococcus luteusC55alpha and C55beta work synergistically at a ratio of 1:1
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00022 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00022.
    • Formula

    • C148H210N40O47S5
    • Absent Amino Acids

    • IPQRV
    • Common Amino Acids

    • CST
    • Mass

    • 3461.84
    • PI

    • 6.72
    • Basic Residues

    • 3
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +1
    • Boman Index

    • -49.18
    • Hydrophobicity

    • -0.633
    • Aliphatic Index

    • 16.33
    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18240
    • Absorbance 280nm

    • 628.97
    • Polar Residues

    • 18

DRAMP00022

DRAMP00022 chydropathy plot
    • Function

    • Active on certain Gram-positive bacteria.
  • ·Literature 1
    • Title

    • Two-component anti-Staphylococcus aureus lantibiotic activity produced by Staphylococcus aureus C55.
    • Reference

    • Appl Environ Microbiol. 1998 Dec;64(12):4803-4808.
    • Author

    • Navaratna MA, Sahl HG, Tagg JR.
  • ·Literature 2
    • Title

    • Identification of genes encoding two-component lantibiotic production in Staphylococcus aureus C55 and other phage group II Staphylococcus aureus strains and demonstration of an association with the exfoliative toxin B gene.
    • Reference

    • Infect Immun. 1999 Aug;67(8):4268-4271.
    • Author

    • Navaratna MA, Sahl HG, Tagg JR.