General Information

    • DRAMP ID

    • DRAMP00178

    • Peptide Name

    • Enterocin EJ97 (EntEJ97; Bacteriocin)

    • Source

    • Enterococcus faecalis EJ97 (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • ej97a

    • Sequence

    • MLAKIKAMIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA

    • Sequence Length

    • 44

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus circulans (MIC=12 µg/ml), Bacillus coagulans CECT 12 (MIC=2 µg/ml), Bacillus megaterium (MIC=4 µg/ml), Bacillus stearothermophilus CECT 49 (MIC=14 µg/ml), Bacillus stearothermophilus CECT 148 (MIC=12 µg/ml), Bacillus subtilis (MIC=12 µg/ml), Paenibacillus macerans CECT 19 (MIC=4 µg/ml), Enterococcus faecalis ssp.faecalis S-13 (MIC=6 µg/ml), E. faecalis ssp.faecalis S-14 (MIC=8 µg/ml), E. faecalis ssp.faecalis S-32 (MIC=12 µg/ml), E. faecalis ssp.faecalis S-86 (MIC=8 µg/ml), E. faecalis ssp.liquefaciens S-39 (MIC=6 µg/ml), E. faecalis ssp.liquefaciens S-40 (MIC=8 µg/ml), E. faecalis ssp. liquefaciens S-47 (MIC=12 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00178 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C252H384N62O61S2

    • Absent Amino Acids

    • CDHS

    • Common Amino Acids

    • K

    • Mass

    • 5322.32

    • PI

    • 9.92

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +6

    • Boman Index

    • -53.64

    • Hydrophobicity

    • -0.589

    • Aliphatic Index

    • 71.14

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18450

    • Absorbance 280nm

    • 429.07

    • Polar Residues

    • 11

DRAMP00178

DRAMP00178 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The genes coding for enterocin EJ97 production by Enterococcus faecalis EJ97 are located on a conjugative plasmid.

    • Reference

    • Appl Environ Microbiol. 2003 Mar;69(3):1633-1641.

    • Author

    • S¡nchez-Hidalgo M, Maqueda M, G¡lvez A, Abriouel H, Valdivia E, Mart­nez-Bueno M.
  • ·Literature 2

    • Title

    • Structural characterisation of the natively unfolded enterocin EJ97.

    • Reference

    • Protein Eng Des Sel. 2010 Jul;23(7):507-518.

    • Author

    • Neira JL, Contreras LM, de los Pa±os OR, S¡nchez-Hidalgo M, Mart­nez-Bueno M, Maqueda M, Rico M.
  • ·Literature 3

    • Title

    • Isolation and characterization of enterocin EJ97, a bacteriocin produced by Enterococcus faecalis EJ97.

    • Reference

    • Arch Microbiol. 1998 Dec;171(1):59-65.

    • Author

    • G¡lvez A, Valdivia E, Abriouel H, Camafeita E, Mendez E, Mart­nez-Bueno M, Maqueda M.