General Information

    • DRAMP ID

    • DRAMP00982

    • Peptide Name

    • Fa-AMP1 (Fagopyrum antimicrobial peptide 1; hevein-type; Plant defensin)

    • Source

    • Fagopyrum esculentum Moench (buckwheat)

    • Family

    • Belongs to the hevein-like family

    • Gene

    • Not found

    • Sequence

    • AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK

    • Sequence Length

    • 40

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Clavibacter michiganensis (IC50=14 µg/ml), Curtobacterium accumfaciens (IC50=13 µg/ml);
      • Gram-negative bacteria: Erwinia carotovora (IC50=11 µg/ml), Agrobacterium radiobacter (IC50=24 µg/ml), Agrobacterium rhizogenes (IC50=20 µg/ml).
      • Fungi: Fusarium oxysporum (IC50=19 µg/ml), Geotrichum candidum (IC50=36 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00982 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00982.

Physicochemical Information

    • Formula

    • C156H237N49O52S8

    • Absent Amino Acids

    • DEFHIMRV

    • Common Amino Acids

    • G

    • Mass

    • 3887.37

    • PI

    • 8.22

    • Basic Residues

    • 2

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +2

    • Boman Index

    • -18.92

    • Hydrophobicity

    • -0.21

    • Aliphatic Index

    • 19.75

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12990

    • Absorbance 280nm

    • 333.08

    • Polar Residues

    • 25

DRAMP00982

DRAMP00982 chydropathy plot

Comments Information

    • Function

    • Has antibacterial avtivity against Gram-positive bacteria and Gram-negative bacteria, also has antifungal activity.

Literature Information

  • ·Literature 1

    • Title

    • Purification, characterization, and sequencing of a novel type of antimicrobial peptides, Fa-AMP1 and Fa-AMP2, from seeds of buckwheat (Fagopyrum esculentum Moench.).

    • Reference

    • Biosci Biotechnol Biochem. 2003 Aug;67(8):1636-1642.

    • Author

    • Fujimura M, Minami Y, Watanabe K, Tadera K.