• DRAMP ID

    • DRAMP01475
    • Peptide Name

    • Esculentin-1ARb (Frogs, amphibians, animals)
    • Source

    • Rana areolata (crawfish frog)
    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)
    • Gene

    • Not found
    • Sequence

    • GLFPKFNKKKVKTGIFDIIKTVGKEAGMDVLRTGIDVIGCKIKGEC
    • Sequence Length

    • 46
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.12429503]Gram-negative bacterium: Escherichia coli (MIC=3 µM);
      • Gram-positive bacterium: Staphylococcus aureus (MIC=60 µM).
    • Hemolytic Activity

      • [Ref:12429503] HC50=120 µM against human erythrocytes
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization (Cys40 and Cys46)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys40 and Cys46.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01475 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C226H381N59O61S3
    • Absent Amino Acids

    • HQSWY
    • Common Amino Acids

    • K
    • Mass

    • 4997.05
    • PI

    • 9.57
    • Basic Residues

    • 10
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +5
    • Boman Index

    • -41.24
    • Hydrophobicity

    • 0.03
    • Aliphatic Index

    • 95.22
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 2.78
    • Polar Residues

    • 13

DRAMP01475

DRAMP01475 chydropathy plot
    • Function

    • Esculentin-1ARb has antibacterial against the Gram-positive bacterium S. aureus and the Gram-negative bacterium E. coli. Also exhibits hemolytic activity against human erythrocytes (HC50=120 µM).
  • ·Literature 1
    • Title

    • Antimicrobial peptides and protease inhibitors in the skin secretions of the crawfish frog, Rana areolata.
    • Reference

    • Biochim Biophys Acta. 2002 Nov 19;1601(1):55-63.
    • Author

    • Ali MF, Lips KR, Knoop FC, Fritzsch B, Miller C, Conlon JM.