General Information

    • DRAMP ID

    • DRAMP01510

    • Peptide Name

    • Esculentin-2-OR4 (Frogs, amphibians, animals)

    • Source

    • Odorrana rotodora (Chinese odorous frog)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GVFTLIKGATQLIGKTLGKELGKTGLELMACKITEQC

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=3.6 µg/mL);
      • Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (MIC=3.6 µg/mL), Bacillus pyocyaneus CMCCB 10104 (MIC=3.6 µg/mL).
      • Yeast: Candida albicans ATCC 2002 (MIC=3.6 µg/mL).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01510 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01510.

Physicochemical Information

    • Formula

    • C172H298N44O51S3

    • Absent Amino Acids

    • DHNPRSWY

    • Common Amino Acids

    • GL

    • Mass

    • 3894.7

    • PI

    • 8.79

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +2

    • Boman Index

    • -6.64

    • Hydrophobicity

    • 0.295

    • Aliphatic Index

    • 108.11

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 3.47

    • Polar Residues

    • 13

DRAMP01510

DRAMP01510 chydropathy plot

Comments Information

    • Function

    • Shows antibacterial activity against both Gram-positive and Gram-negative bacteria and against the fungus C. albicans.

Literature Information

  • ·Literature 1

    • Title

    • Extremely abundant antimicrobial peptides existed in the skins of nine kinds of Chinese odorous frogs.

    • Reference

    • J Proteome Res. 2012 Jan 1;11(1):306-319.

    • Author

    • Yang X, Lee WH, Zhang Y.