• DRAMP ID

    • DRAMP01510
    • Peptide Name

    • Esculentin-2-OR4 (Frogs, amphibians, animals)
    • Source

    • Odorrana rotodora (Chinese odorous frog)
    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)
    • Gene

    • Not found
    • Sequence

    • GVFTLIKGATQLIGKTLGKELGKTGLELMACKITEQC
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=3.6 µg/mL);
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC 25923MIC=3.6 µg/mL
        Bacillus pyocyaneus CMCCB 10104MIC=3.6 µg/mL
      • Yeast: Candida albicans ATCC 2002 (MIC=3.6 µg/mL).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01510 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01510.
    • Formula

    • C172H298N44O51S3
    • Absent Amino Acids

    • DHNPRSWY
    • Common Amino Acids

    • GL
    • Mass

    • 3894.7
    • PI

    • 8.79
    • Basic Residues

    • 5
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +2
    • Boman Index

    • -6.64
    • Hydrophobicity

    • 0.295
    • Aliphatic Index

    • 108.11
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 3.47
    • Polar Residues

    • 13

DRAMP01510

DRAMP01510 chydropathy plot
    • Function

    • Shows antibacterial activity against both Gram-positive and Gram-negative bacteria and against the fungus C. albicans.
  • ·Literature 1
    • Title

    • Extremely abundant antimicrobial peptides existed in the skins of nine kinds of Chinese odorous frogs.
    • Reference

    • J Proteome Res. 2012 Jan 1;11(1):306-319.
    • Author

    • Yang X, Lee WH, Zhang Y.