• • DRAMP ID

  • DRAMP01638

• • Peptide Name

  • Dermaseptin-L1 (Frogs, amphibians, animals)

• • Source

  • Hylomantis lemur (Lemur leaf frog)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS

• • Sequence Length

  • 32

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)CN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)O)C(C)C)[C@@H](C)O)C(C)C

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-negative bacterium:

      Target Organism	Activity
      Escherichia coli	MIC=8 µM

    • Fungi:

      Target Organism	Activity
      Batrachochytrium dendrobatidis	MIC>100 µM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.17561225]Displayed cytotoxic against HepG2 cells(LC50=45μM)

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

• Predicted Structure

• There is no predicted structure for DRAMP01638.

DRAMP01638

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae).

• • Pubmed ID

  • 17561225

• • Reference

  • Toxicon. 2007 Sep 15;50(4):498-506.

• • Author

  • Conlon JM, Woodhams DC, Raza H, Coquet L, Leprince J, Jouenne T, Vaudry H, Rollins-Smith LA.