• DRAMP ID

    • DRAMP01667
    • Peptide Name

    • Dermaseptin-J10 (DRS-J10; Frogs, amphibians, animals)
    • Source

    • Phasmahyla jandaia (Jandaia leaf frog)
    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)
    • Gene

    • Not found
    • Sequence

    • ALWKSLLKGAGQLVGGVVQHFMGSQGQPES
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C139H221N39O40S
    • Absent Amino Acids

    • CDINRTY
    • Common Amino Acids

    • G
    • Mass

    • 3110.58
    • PI

    • 8.64
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +2
    • Boman Index

    • -6.21
    • Hydrophobicity

    • 0.01
    • Aliphatic Index

    • 87.67
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 189.66
    • Polar Residues

    • 9

DRAMP01667

DRAMP01667 chydropathy plot
    • Function

    • Antimicrobial peptide.
    • Tissue specificity

    • Expressed by the skin glands.
    • PTM

    • C-terminal amidation.
  • ·Literature 1
    • Title

    • Peptidomic dissection of the skin secretion of Phasmahyla jandaia (Bokermann and Sazima, 1978) (Anura, Hylidae, Phyllomedusinae).
    • Reference

    • Toxicon. 2011 Jan;57(1):35-52.
    • Author

    • Rates B, Silva LP, Ireno IC, Leite FS, Borges MH, Bloch C Jr, De Lima ME, Pimenta AM.