• DRAMP ID

    • DRAMP01876
    • Peptide Name

    • Brevinin-2PRb (Frogs, amphibians, animals)
    • Source

    • Rana pirica (Hokkaido frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GLMSLFRGGVLKTAGKHIFKNVGGSLLDQAKCKITGEC
    • Sequence Length

    • 38
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.15003829] Gram-negative bacterium:
        Target OrganismActivity
        Escherichia coliMIC=3μM
        Pseudemonas aeruginosaMIC=3μM
        Enterobacter cloacaeMIC=6μM
        Klebsiella pneumoniae(MIC=6μM);-
      • Gram-positive bacterium:
        Target OrganismActivity
        Staphylococcus aureus(MIC=25μM);-
      • Yeast:
        Target OrganismActivity
        Candida albicansMIC>100μM
    • Hemolytic Activity

      • [Ref.15003829] HC50=65 μM against human erythrocytes
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.
    • Stereochemistry

    • L
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C175H294N50O49S3
    • Absent Amino Acids

    • PWY
    • Common Amino Acids

    • G
    • Mass

    • 3978.74
    • PI

    • 9.59
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +5
    • Boman Index

    • -23.39
    • Hydrophobicity

    • 0.145
    • Aliphatic Index

    • 92.37
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 3.38
    • Polar Residues

    • 14

DRAMP01876

    • Function

    • activity against reference strains of Gram-negative (Escherichia coli, Pseudomonas aeruginosa, Enterobacter cloacae, Klebsiella pneumoniae) and Gram-positive (Staphlococcus aureus) bacteria but displayed relatively low hemolytic activity.
  • ·Literature 1
    • Title

    • A family of brevinin-2 peptides with potent activity against Pseudomonas aeruginosa from the skin of the Hokkaido frog, Rana pirica.
    • Reference

    • Regul Pept. 2004 May 15;118(3):135-141.
    • Author

    • Conlon JM, Sonnevend A, Patel M, Al-Dhaheri K, Nielsen PF, Kolodziejek J, Nowotny N, Iwamuro S, P