• DRAMP ID

    • DRAMP02425
    • Peptide Name

    • Ixosin-B (Ticks, Arthropods, animals)
    • Source

    • Ixodes sinensis (Hard tick)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY
    • Sequence Length

    • 32
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • [Ref.18295522]Gram-positive bacterium:
        Target OrganismActivity
        Staphylococcus aureus (MIC=2.5 µg/mL);-
      • Gram-negative bacterium:
        Target OrganismActivity
        Escherichia coli (MIC=15 µg/mL);-
      • Yeast:
        Target OrganismActivity
        Candida albicansMIC=7.5 µg/mL
    • Hemolytic Activity

      • [Ref.18295522]Little hemolytic activity on rabbit red blood cells up to 200 μg/mL
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C165H262N56O49
    • Absent Amino Acids

    • ACFMN
    • Common Amino Acids

    • RS
    • Mass

    • 3814.24
    • PI

    • 10.88
    • Basic Residues

    • 8
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +5
    • Boman Index

    • -120.62
    • Hydrophobicity

    • -1.394
    • Aliphatic Index

    • 54.69
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12490
    • Absorbance 280nm

    • 402.9
    • Polar Residues

    • 10

DRAMP02425

DRAMP02425 chydropathy plot
    • Function

    • Has antifungal and antibacterial activity. Ixosin-B has little hemolytic activity on red blood cells even with peptide
    • concentrations up to 200 µg/mL.

  • ·Literature 1
    • Title

    • Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis.
    • Reference

    • Comp Biochem Physiol B Biochem Mol Biol. 2008 Apr;149(4):557-561.
    • Author

    • Liu Z, Liu H, Liu X, Wu X.