• DRAMP ID

    • DRAMP02478
    • Peptide Name

    • L-amino-acid oxidase (Bm-LAO; LAAO; LAO; Snakes, reptiles, animals)
    • Source

    • Bothropoides matogrossensis (Pitviper) (Bothrops neuwiedimatogrossensis)
    • Family

    • Belongs to the flavin monoamine oxidase family (FIG1 subfamily)
    • Gene

    • Not found
    • Sequence

    • IKFEPPLPPKKAHKKFWEDDGIYYPPNHNFP
    • Sequence Length

    • 31
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiparasitic
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtilis strain ATCC 6633MIC=32 µM
        Enterococcus faecalis strain ATCC 12953MIC=32 µM
        Staphylococcus aureus strain ATCC 29213MIC=32 µM
        Streptococcus pyogenes strain ATCC 19615MIC=8 µM
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli strain ATCC 8739MIC=4 µM
        Klebsiella pneumoniaee strain ATCC 13885MIC=2 µM
        Proteus mirabilis strain ATCC 25933MIC=2 µM
        Pseudomonas aeruginosa strain ATCC 15442MIC=8 µM
        Salmonella typhimurium strain ATCC 14028MIC=8 µM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C182H257N43O44
    • Absent Amino Acids

    • CMQRSTV
    • Common Amino Acids

    • P
    • Mass

    • 3751.3
    • PI

    • 8.32
    • Basic Residues

    • 7
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +3
    • Boman Index

    • -52.91
    • Hydrophobicity

    • -1.258
    • Aliphatic Index

    • 40.97
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 282.67
    • Polar Residues

    • 5

DRAMP02478

    • Function

    • Catalyzes an oxidative deamination of predominantly hydrophobic and aromatic L-amino acids, thus producing hydrogen peroxide that may contribute to the diverse toxic effects of this enzyme. Exhibits diverse biological activities, such as hemorrhage, hemolysis, edema, antibacterial and antiparasitic activities, as well as regulation of platelet aggregation. Its effect on platelets is controversial, since it either induces aggregation or inhibits agonist-induced aggregation. These different effects are probably due to different experimental conditions (By similarity).
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Evaluation of an antimicrobial L-amino acid oxidase and peptide derivatives from Bothropoides mattogrosensis pitviper venom.
    • Reference

    • PLoS One. 2012;7(3):e33639.
    • Author

    • Okubo BM, Silva ON, Migliolo L, Gomes DG, Porto WF, Batista CL, Ramos CS, Holanda HH, Dias SC, Franco OL, Moreno SE.