• • DRAMP ID

  • DRAMP02931

• • Peptide Name

  • Arasin-likeSp (crabs, Arthropods, animals)

• • Source

  • Scylla paramamosain (Mud crab)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • SPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG

• • Sequence Length

  • 41

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-positive bacteria:

      Target Organism	Activity
      Staphylococcus haemolyticus	MIC=6.25-12.5 µM
      Aerococcus viridans	MIC=0.19-0.39 µM
      Micrococcus luteus	MIC=0.39-0.78 µM
      Bacillus subtilis (MIC=6.25-12.5 µM);	-

    • Gram-negative bacteria:

      Target Organism	Activity
      Escherichia coli 363	MIC>50 µM
      Aeromonas hydrophila	MIC>50 µM
      V. harveyi	MIC=0.78-1.56 µM
      Vibrio anguillarum	MIC=3.125-6.25 µM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02931.

DRAMP02931

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Two novel antimicrobial peptides, arasin-likeSp and GRPSp, from the mud crab Scylla paramamosain, exhibit the activity against some crustacean pathogenic bacteria.

• • Pubmed ID

  • 21220028

• • Reference

  • Fish Shellfish Immunol. 2011 Feb;30(2):706-712.

• • Author

  • Imjongjirak C, Amparyup P, Tassanakajon A.