• DRAMP ID

    • DRAMP02941
    • Peptide Name

    • Tachystatin-A1 (crabs, Arthropods, animals)
    • Source

    • Tachypleus tridentatus (Japanese horseshoe crab)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF
    • Sequence Length

    • 44
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium:
        Target OrganismActivity
        Escherichia coli (IC50=25 µg/ml);-
      • Gram-positive bacterium:
        Target OrganismActivity
        Staphylococcus aureusIC50=4.2 µg/ml
      • Fungi:
        Target OrganismActivity
        Candida albicansIC50=3.0 µg/ml
        Pichia pastorisIC50=0.5 µg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Chitin-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02941 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02941.
    • Formula

    • C219H336N66O60S6
    • Absent Amino Acids

    • ADEHKMW
    • Common Amino Acids

    • CR
    • Mass

    • 5045.84
    • PI

    • 9.38
    • Basic Residues

    • 6
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +6
    • Boman Index

    • -85.57
    • Hydrophobicity

    • -0.241
    • Aliphatic Index

    • 48.64
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6335
    • Absorbance 280nm

    • 147.33
    • Polar Residues

    • 23

DRAMP02941

DRAMP02941 chydropathy plot
    • Function

    • Exhibits stronger antimicrobial activity against the Gram-positive bacterium S. aureus and fungi C. albicans and P. pastoris than Gram-negative bacterium E. coli. Binds to chitin (8.4 µM are required to obtain 50% of binding). Does not cause hemolysis on sheep erythrocytes. Has no blocking activity on the P-type calcium channel.
    • Tissue specificity

    • Granular hemocytes, small secretory granules.
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.
    • Reference

    • J Biol Chem. 1999 Sep 10;274(37):26172-26178.
    • Author

    • Osaki T, Omotezako M, Nagayama R, Hirata M, Iwanaga S, Kasahara J, Hattori J, Ito I, Sugiyama H, Kawabata S.