• • DRAMP ID

  • DRAMP03004

• • Peptide Name

  • Abaecin (Insects, animals)

• • Source

  • Bombus pascuorum (Brown bumblebee)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH

• • Sequence Length

  • 39

• • UniProt Entry

  • P81463

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram-

• • Target Organism

  • • Gram-negative bacteria: Micrococcus luteus;
    • Gram-negative bacteria: Escherichia coli D22.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03004.

DRAMP03004

• • Function

  • Antibacterial peptide against Gram-positive and Gram-negative bacteria.

• • Induction

  • By bacterial infection.

• ·Literature 1

• • Title

  • Novel antibacterial peptides isolated from a European bumblebee, Bombus pascuorum (Hymenoptera, Apoidea).

• • Pubmed ID

  • 9219367

• • Reference

  • Insect Biochem Mol Biol. 1997 May;27(5):413-22.

• • Author

  • Rees JA, Moniatte M, Bulet P.