• • DRAMP ID

  • DRAMP03150

• • Peptide Name

  • Gambicin (Insects, animals)

• • Source

  • Anopheles albimanus (mosquito)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • MVFAYAPTCARCKSIGARYCGYGYLNRKGVSCDGQTTINSCEDCKRKFGRCSDGFITECFL

• • Sequence Length

  • 61

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • SMILES

  • CC[C@@H](C)[C@@H]1NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]2CSSC[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@H]3CSSC[C@@H]4NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](Cc5ccccc5)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@@H](C(=O)N[C@@H](Cc5ccccc5)C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H]([C@H](C)CC)NC(=O)[C@H](Cc5ccccc5)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC4=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC3=O)[C@H](C)CC)[C@@H](C)O)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc3ccc(O)cc3)NC(=O)CNC(=O)[C@H](Cc3ccc(O)cc3)NC(=O)CNC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H]3CCCN3C(=O)[C@H](C)NC(=O)[C@H](Cc3ccc(O)cc3)NC(=O)[C@H](C)NC(=O)[C@H](Cc3ccccc3)NC(=O)[C@@H](NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N2)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)CNC1=O

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiparasitic

• • Target Organism

  • • Gram-negative bacterium:

      Target Organism	Activity
      E. coli (MIC=6.25-12.5 µM);	-

    • Gram-positive bacterium:

      Target Organism	Activity
      M. luteus	MIC=25-50 µM

    • Fungus:

      Target Organism	Activity
      N. crassa	-

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bonds between Cys9 and Cys20; Cys12 and Cys32; Cys41 and Cys51,Cys44 and Cys59.

• • Stereochemistry

  • L

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP03150_predicted_structure.pdb to download.

DRAMP03150

• • Function

  • In vitro experiments showed that the 6.8-kDa mature peptide can kill both Gram-positive and Gram-negative bacteria, has a morphogenic effect on a filamentous fungus, and is marginally lethal to Plasmodium berghei ookinetes.

• • Induction

  • Predominantly expressed in the anterior part.

• • PTM

  • Contains four disulfide bridges.

• ·Literature 1

• • Title

  • Gambicin: a novel immune responsive antimicrobial peptide from the malaria vector Anopheles gambiae.

• • Pubmed ID

  • 11606751

• • Reference

  • Proc Natl Acad Sci U S A. 2001 Oct 23;98(22):12630-5.

• • Author

  • Vizioli J, Bulet P, Hoffmann JA, Kafatos FC, Müller HM, Dimopoulos G.