• DRAMP ID

    • DRAMP03304
    • Peptide Name

    • Hydramacin-1 (Hm-1; annelida, animals)
    • Source

    • Hydra vulgaris (Hydra) (Hydra attenuata)
    • Family

    • Belongs to the macin family
    • Gene

    • Not found
    • Sequence

    • QIVDCWETWSRCTKWSQGGTGTLWKSCNDRCKELGRKRGQCEEKPSRCPLSKKAWTCICY
    • Sequence Length

    • 60
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Acinetobacter baumannii ATCC 19606MBC=7.1 µM
        Burkholderia cepacia ATCC 25416MBC>14.3 μM
        Burkholderia cepacia ATCC 17759MBC>14.3 μM
        B. cepacia LMG 16654MBC>14.3 μM
        Citrobacter freundii NCTC 9750MBC=7.1 μM
        C. freundii C7MBC=0.9 μM
        Enterobacter cloacae Va11263/03MBC>14.3 μM
        E. cloacae Va12270/03MBC=0.9 μM
        Escherichia coli ATCC 25922MBC=0.9 μM
        Klebsiella pneumoniae ATCC 13883MBC=0.9 μM
        Klebsiella oxytoca ATCC 13182MBC=0.9 μM
        Proteus mirabilis ATCC 21100MBC=14.3 μM
        P. vulgaris ATCC 13315MBC>14.3 μM
        Providencia rettgeri NCTC 7475MBC>14.3 μM
        Pseudomonas aeruginosa NCTC 11446MBC>14.3 μM
        Salmonella typhimurium 10003442MBC=0.9 μM
        S. typhimurium 10003630MBC=0.9 μM
        Serratia marcescens Mero060/148MBC>14.3 µM
        S. marcescens Mero103/013MBC>14.3 μM
        S. marcescens NCTC 10211MBC>14.3 μM
        Yersinia enterocolitica NCTC 11176MBC=0.9 µM
      • Multi-resistant Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli Co 86 ESBLMBC=3.6 μM
        Klebsiella oxytoca ESBL 33MBC=7.1 µM
        K. oxytoca ESBL 37MBC=3.6 μM
        Klebsiella pneumoniae ATCC 700603MBC=3.6 μM
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC 6538MBC>14.3 μM
        Staphylococcus haemolyticus ATCC 29970MBC=1.8 μM
        Streptococcus pyogenes ATCC 12344MBC>14.3 μM
      • Multi-resistant Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC 33593 (MRSA)MBC>14.3 μM
        Enterococcus faecalis ATCC 51299MBC>14.3 μM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • cell membrane
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • 2K35 resolved by NMR.
    • Predicted Structure

    • Formula

    • C300H471N91O88S8
    • Absent Amino Acids

    • FHM
    • Common Amino Acids

    • CK
    • Mass

    • 7017.08
    • PI

    • 9.05
    • Basic Residues

    • 12
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +6
    • Boman Index

    • -154.34
    • Hydrophobicity

    • -0.948
    • Aliphatic Index

    • 39
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 29490
    • Absorbance 280nm

    • 499.83
    • Polar Residues

    • 25

DRAMP03304

DRAMP03304 chydropathy plot
    • Function

    • Hydramacin-1 is potently active against Gram-positive and Gram-negative bacteria including multi-resistant human pathogenic strains. Is not active against the Gram-positive Coccus species, Gram-negative non-fermentation species and against the fungus C.albicans. It leads to aggregation of bacteria as an initial step of its bactericidal mechanism. Aggregated cells are connected via electron-dense contacts and adopt a thorn apple-like morphology. Hydramycin contains a belt of positively charged residues that separate two hydrophobic areas. This structure may explain the observed aggregation of bacteria, since each of these areas can immerse into the outer leaflets of the membranes of two individual bacteria. Is able to permeabilize membranes of viable bacteria at low and neutral pH values, but no pore-forming activity is not detected.
    • Tissue specificity

    • Expressed in the endodermal epithelium.
    • Induction

    • By bacterial lipopolysaccharides (LPS).
    • PTM

    • Contains four disulfide bonds.
  • ·Literature 1
    • Title

    • Uncovering the evolutionary history of innate immunity: the simple metazoan Hydra uses epithelial cells for host defence.
    • Reference

    • Dev Comp Immunol. 2009 Apr;33(4):559-569.
    • Author

    • Bosch TC, Augustin R, Anton-Erxleben F, Fraune S, Hemmrich G, Zill H, Rosenstiel P, Jacobs G, Schreiber S, Leippe M, Stanisak M, Grötzinger J, Jung S, Podschun R, Bartels J, Harder J, Schröder JM.
  • ·Literature 2
    • Title

    • Hydramacin-1, structure and antibacterial activity of a protein from the basal metazoan Hydra.
    • Reference

    • J Biol Chem. 2009 Jan 16;284(3):1896-1905.
    • Author

    • Jung S, Dingley AJ, Augustin R, Anton-Erxleben F, Stanisak M, Gelhaus C, Gutsmann T, Hammer MU, Podschun R, Bonvin AM, Leippe M, Bosch TC, Grötzinger J.