• DRAMP ID

    • DRAMP04523
    • Peptide Name

    • Odorranain-P1b antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Odorrana grahami (Yunnanfu frog) (Rana grahami)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTMKKSLLLLFFLGTINLSFCQEEVRNADEEERRDERDVEVEKRVIPFVASVAAEMMQHVYCAASKKC
    • Sequence Length

    • 69
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C352H565N95O105S7
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • E
    • Mass

    • 8032.35
    • PI

    • 5.33
    • Basic Residues

    • 11
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 26
    • Net Charge

    • -1
    • Boman Index

    • -130.12
    • Hydrophobicity

    • -0.116
    • Aliphatic Index

    • 83.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 23.75
    • Polar Residues

    • 13

DRAMP04523

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Anti-infection peptidomics of amphibian skin.
    • Reference

    • Mol. Cell. Proteomics. 2007,6:882-894.
    • Author

    • Li J, Xu X, Xu C, Zhou W, Zhang K, Yu H, Zhang Y, Zheng Y,Rees H.H, Lai R, Yang D, Wu J.