• DRAMP ID

    • DRAMP18225
    • Peptide Name

    • Subtilosin A1 (Bacteriocin)
    • Source

    • Bacillus subtilis
    • Family

    • Belongs to the class I bacteriocin
    • Gene

    • Not found
    • Sequence

    • NKGCAICSIGAACLVDGPIPDFEIAGATGLFGLWG
    • Sequence Length

    • 35
    • UniProt Entry

    • No entry found
    • Protein Existence

    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

      • [Ref.19633086]Gram-postive bacterium:
        Target OrganismActivity
        Bacillus subtilisMIC= 250μM
        Bacillus anthracisMIC= 16μM
        Bacillus cereusMIC= 40μM
        Bacillus thuringiensisMIC= 40μM
        Enterococcus faecalisMIC= 100μM
        taphylococcus carnosusMIC= 100μM
        Listeria monocytogenesMIC= 40μM
        Streptococcus pyogenesMIC= 100μM
    • Hemolytic Activity

      • [Ref.19633086] MLC=16 μM against rabbit blood agar
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • Thioether bridges between Cys4 and Phe31,Cys7 and Thr28,Cys13 and Phe22.
    • Stereochemistry

    • Mixed(D-Thr28,D-Phe31)
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C154H238N38O45S3
    • Absent Amino Acids

    • HMQRY
    • Common Amino Acids

    • G
    • Mass

    • 3437.99
    • PI

    • 4.03
    • Basic Residues

    • 1
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 16
    • Net Charge

    • -2
    • Boman Index

    • 2383
    • Hydrophobicity

    • 0.84
    • Aliphatic Index

    • 100.57
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5625
    • Absorbance 280nm

    • 165.44
    • Polar Residues

    • 13

DRAMP18225

DRAMP18225 chydropathy plot
    • Fuction

    • Active against B. anthracis, B. cereus, B. thuringiensis, E. faecalis, S. carnosus, L. monocytogenes, and S. pyogenes. In addition to the hemolytic activity, subtilosin A1 was found to exhibit enhanced antimicrobial activity against specific bacterial strains.
  • ·Literature 1
    • Title

    • Isolation of a variant of subtilosin A with hemolytic activity.
    • Reference

    • J Bacteriol. 2009 Sep;191(18):5690-6.
    • Author

    • Huang T, Geng H, Miyyapuram VR, Sit CS, Vederas JC, Nakano MM.