• DRAMP ID

    • DRAMP18717
    • Peptide Name

    • Charybdotoxin (Yellow scorpions, arachnids, Chelicerata, arthropods, invertebrates, animals)
    • Source

    • Leiurus quinquestriatus hebraeus
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • [Ref.15118082]Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtilisInhibition zone=4 mm completely inhibit in PH5.5, Inhibition zone=7 mm incompletely inhibit and Inhibition zone=6 mm in PH7.5 completely inhibit at 10 μg/well
        Staphylococcus aureus (Inhibition zone=3 mm incompletely inhibit in PH5.5, Inhibition zone=6 mm incompletely inhibit and Inhibition zone=1 mm completely inhibit in PH7.5 at 10 μg/well);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli (Inhibition zone=2 mm incompletely inhibit in PH5.5, Inhibition zone=8 mm incompletely inhibit in PH7.5 at 10 μg/well);-
      • Fungi:
        Target OrganismActivity
        Candida albicansInhibition zone=13 mm completely inhibit in PH5.5, Inhibition zone=15 mm in PH7.5 completely inhibit at 10 μg/well
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine Helix and Beta structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18717 helical wheel diagram
    • PDB ID

    • 2CRD resolved by NMR
    • Predicted Structure

    • There is no predicted structure for DRAMP18717.
    • Formula

    • C176H285N57O56S7
    • Absent Amino Acids

    • ADIP
    • Common Amino Acids

    • C
    • Mass

    • 4319.97
    • PI

    • 9.13
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +6
    • Boman Index

    • -10884
    • Hydrophobicity

    • -0.832
    • Aliphatic Index

    • 26.22
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 204.58
    • Polar Residues

    • 20

DRAMP18717

DRAMP18717 chydropathy plot
    • Function

    • Antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and fungi.
  • ·Literature 1
    • Title

    • Multidimensional signatures in antimicrobial peptides.
    • Reference

    • Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8.
    • Author

    • Yount NY, Yeaman MR.