General Information

    • DRAMP ID

    • DRAMP29155

    • Peptide Name

    • EK1C2

    • Source

    • Synthetic construct

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSG

    • Sequence Length

    • 39

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

    • SMILES

    • Not available

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral(SARS-CoV-2)

    • Target Organism

      • [Ref.32231345]Virus:
      • SARS-CoV-2:
        Target OrganismActivity
        ihibition of cell-cell fusion in 293T/ACE2 cellsIC50=48.2 nM
        inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cellsIC50=418.6 nM

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • liposomes

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Chol

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C203H328N46O68S

    • Absent Amino Acids

    • CHPRW

    • Common Amino Acids

    • EL

    • Mass

    • 4533.16

    • PI

    • 4.36

    • Basic Residues

    • 5

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 13

    • Net Charge

    • -5

    • Boman Index

    • -6455

    • Hydrophobicity

    • -0.441

    • Aliphatic Index

    • 110

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 78.42

    • Polar Residues

    • 9

DRAMP29155

Comments Information

    • Mechanism of action

    • The peptide acted as a fusion inhibitor which against SARS-CoV-2 S protein-mediated membrane fusion and pseudovirus infection.

Literature Information

  • ·Literature 1

    • Title

    • Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.

    • Reference

    • Cell Res. 2020 Apr;30(4):343-355.

    • Author

    • Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.