• • DRAMP ID

  • DRAMP29200

• • Peptide Name

  • EK1-GSGSGC

• • Source

  • Synthetic construct

• • Family

  • Belongs to the betacoronaviruses spike protein family.

• • Gene

  • S

• • Sequence

  • SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGC

• • Sequence Length

  • 42

• • UniProt Entry

  • Q8BB25

• • Protein Existence

  • Hemology

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)CC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CC[C@H](NC(=O)[C@H](CCC(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O)[C@H](C)CC)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(=O)N[C@@H](CCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)C(=O)NCC(=O)NCC(=O)NCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)O)[C@H](C)CC

• • Biological Activity

  • Antimicrobial, Antiviral(SARS-CoV-2)

• • Target Organism

  • • [Ref.33082259]Virus:
    • SARS-CoV-2:

      Target Organism	Activity
      ihibition of cell-cell fusion in 293T cells	IC50=293±60 nM,IC90>900 nM
      inhibition of infection in Vero E6 cells	IC50~ 41 nM

    • SARS-CoV-2_D614G:

      Target Organism	Activity
      ihibition of cell-cell fusion in 293T cells	IC50=261±136 nM,IC90=892±100 nM

    • SARS-CoV-2_S943P:

      Target Organism	Activity
      ihibition of cell-cell fusion in 293T cells	IC50=286±104 nM,IC90>1000 nM

    • SARS-CoV-2_S247R:

      Target Organism	Activity
      ihibition of cell-cell fusion in 293T cells	IC50=194±107 nM,IC90=893±77 nM

    • MERS-CoV:

      Target Organism	Activity
      ihibition of cell-cell fusion in 293T cells	IC50>1000 nM,IC90>1000 nM
      inhibition of infection in Vero E6 cells	IC50~ 2 nM

    • SARS-CoV-1:

      Target Organism	Activity
      ihibition of cell-cell fusion in 293T cells	IC50=36±5 nM,IC90>1000 nM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • [Ref.33082259]Human embryonic kidney HEK293T cells:<5% Cytotoxicity at 10 µM;Vero E6 cells:18% Cytotoxicity at 10 µM.

• • Binding Target

  • liposomes

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP29200_predicted_structure.pdb to download.

DRAMP29200

• • Mechanism of action

  • The lipopeptide is derived from the C-terminal heptad repeat (HRC) domain of SARS-CoV-2 S that potently inhibits infection by SARS-CoV-2.

• ·Literature 1

• • Title

  • Inhibition of Coronavirus Entry In Vitro and Ex Vivo by a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain.

• • Pubmed ID

  • 33082259

• • Reference

  • mBio. 2020 Oct 20;11(5):e01935-20.

• • Author

  • Outlaw VK, Bovier FT, Mears MC, Cajimat MN, Zhu Y, Lin MJ, Addetia A, Lieberman NAP, Peddu V, Xie X, Shi PY, Greninger AL, Gellman SH, Bente DA, Moscona A, Porotto M.