Patent Information

    • DRAMP ID

    • DRAMP04754

    • Sequence

    • TLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

    • Sequence Length

    • 41

    • Sequence Name

    • Sequence 3 from Patent US 20020115602

    • Source

    • Synthetic construct

    • Activity

    • Antimicrobial

    • Patent Type

    • Patent Application

    • Publication Date

    • 2002-8-22

    • Patent Title

    • Human beta-defensin-3 (HBD-3), a highly cationic beta-defensin antimicrobial peptide.

    • Abstract

    • The present invention relates a novel antimicrobial peptide HBD-3 and derivatives thereof as well as the gene encoding the peptide. The invention further relates to methods of use of the HBD-3 peptide including a method of inhibiting microbial growth by administering an effective amount of the HBD-3 peptide alone or in combinination with other antimicrobial agents or antibiotics. In addition, the immunomodulatory properties of the HBD-3 peptide also facilitate the manipulation of the immune response, i.e., as a chemoattractant for immature dentritic cells or memory T cells.