Patent Information

    • DRAMP ID

    • DRAMP04817

    • Sequence

    • ACYCRIPACIAGERRYGTCIYQGRLWAFCC

    • Sequence Length

    • 30

    • Sequence Name

    • Sequence 8 from Patent US 20030092612

    • Source

    • Human

    • Activity

    • Antimicrobial

    • Patent Type

    • Patent Application

    • Publication Date

    • 2003-5-15

    • Patent Title

    • Use of antimicrobial peptides as preservatives in ophthalmic preparations, including solutions, emulsions, and suspensions.

    • Abstract

    • Methods for preserving ophthalmic compositions are disclosed. In one embodiment, such compositions include a liquid medium and an antimicrobial component which is preferably substantially non-oxidative. Compositions which include a liquid medium and antimicrobial peptide magainins, present in an amount effective as a preservative, are also disclosed. Preserved compositions useful for administering a therapeutic component to the eyes or caring for contact lenses are also included within the scope of the present invention.