Patent Information

    • DRAMP ID

    • DRAMP04889

    • Sequence

    • VSCCMIGGICRYLCKGNILQNGNCGVTSLNCCKR

    • Sequence Length

    • 34

    • Sequence Name

    • Sequence 14 from Patent US 20030176652

    • Source

    • Mus musculus

    • Activity

    • Antimicrobial

    • Patent Type

    • Patent Application

    • Publication Date

    • 2003-9-18

    • Patent Title

    • Human and mouse beta-defensins, antimicrobial peptides.

    • Abstract

    • The present invention employs an iterative application of BLAST and Hidden Markov Model (HMM) based searches which identified 34 beta-defensin genes in the human genome and 48 in the mouse genome. The present invention relates to novel antimicrobial peptides and derivatives thereof as well as the beta-defensin genes encoding the peptides. The invention further relates to methods of use of the peptides including a method of inhibiting microbial growth by administering an effective amount of the peptide alone or in combination with other antimicrobial agents or antibiotics.