• DRAMP ID

    • DRAMP05103
    • Sequence

    • AHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGP
    • Sequence Length

    • 93
    • Sequence Name

    • Sequence 6 from Patent US 20040037781
    • Source

    • Homo sapiens
    • Activity

    • Antimicrobial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2004-2-26
    • Patent Title

    • Peptides with antioxidant and antimicrobial properties.
    • Abstract

    • Methods of treating conditions associated with lipid oxidation or microbial proliferation include the step of administering a composition comprising a pharmacologically effective amount of an antioxidant or antimicrobial lung surfactant protein compound. Peptides derived from lung surfactant protein compounds possess lipid oxidation inhibiting and/or antimicrobial properties.