Patent Information

    • DRAMP ID

    • DRAMP05105

    • Sequence

    • AYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIED

    • Sequence Length

    • 92

    • Sequence Name

    • Sequence 15 from Patent US 20040037781

    • Source

    • Synthetic construct

    • Activity

    • Antimicrobial

    • Patent Type

    • Patent Application

    • Publication Date

    • 2004-2-26

    • Patent Title

    • Peptides with antioxidant and antimicrobial properties.

    • Abstract

    • Methods of treating conditions associated with lipid oxidation or microbial proliferation include the step of administering a composition comprising a pharmacologically effective amount of an antioxidant or antimicrobial lung surfactant protein compound. Peptides derived from lung surfactant protein compounds possess lipid oxidation inhibiting and/or antimicrobial properties.