-
-
Sequence
- YNYIDCPVGCRACYMRCIDGQCIPFIKKLILFHLYVIVE
-
-
Sequence Name
- Sequence 886 from Patent US 20120157374
-
Source
- Synthetic construct
-
-
-
Patent Type
- Patent Application
-
Publication Date
- 2012-6-21
-
-
Patent Title
- Nodule specific medicago peptides having antimicrobial activity and pharmaceutical compositions containging the same.
-
Abstract
- The present invention relates to the use of at least one peptide originated from Medicago truncatula nodules, including the SEQ IDs NO: 1-463 or at least one peptide having a sequence derived from the SEQ IDs NO: 1-463 by deletion of about 9 to about 44 contiguous amino acids, from the N-terminal part of the peptide, in particular peptides having the SEQ IDS NO: 464 to 925, for the preparation of a drug intended for the treatment of human, animal or plant diseases induced by microorganisms, wherein the peptides have a broad-spectrum and fast antibiotic activity, in particular killing of the bacteria within 1 to 3 hours.