• DRAMP ID

    • DRAMP28412
    • Sequence

    • MLIFVHIIAPVISGCAIAFFSYWLSRRNTK
    • Sequence Length

    • 30
    • Sequence Name

    • Sequence 15 from Patent US 10220112
    • Source

    • Synthetic construct
    • Activity

    • Antimicrobial, Antibacterial
    • Patent Type

    • Granted Patent
    • Publication Date

    • 2019-3-5
    • Patent Title

    • Cyclic Antimicrobial Pseudopeptides And Uses Thereof
    • Abstract

    • The present invention provides cyclic antimicrobial pseudopeptides that are useful in a variety of applications. Also provided are pharmaceutical compositions, products and kits comprising such cyclic antimicrobial peptides and methods of using these antimicrobial peptides for modifying infectivity, killing microorganisms or inhibiting microbial growth or function and for preventing and/or treating an infection or contamination caused by such microorganisms.