Patent Information

    • DRAMP ID

    • DRAMP28422

    • Sequence

    • MFTLKKPLLLIFFLGTINLSLCQEESNAEEERRDDDDDQMNVEVEKRFFPGIIKVAGAILPTAICAITKRC

    • Sequence Length

    • 71

    • Sequence Name

    • Sequence 6 from Patent US 20190298796

    • Source

    • Synthetic construct

    • Activity

    • Antimicrobial, Antibacterial

    • Patent Type

    • Patent Application

    • Publication Date

    • 2019-10-3

    • Patent Title

    • Therapeutic Compositions From The Brevinin-1 Family Of Peptides And Uses Thereof

    • Abstract

    • The invention is directed to peptides and methods of making and using antimicrobial compositions for the treatment of a bacterium, wherein the composition comprises: a pharmaceutically effective amount of a modified brevinin-1 peptide, as well as modified and truncated versions thereof, disposed in a pharmaceutical carrier.