• DRAMP ID

    • DRAMP28509
    • Sequence

    • GHGRQGSGSRQSPSHVRHGSGSGHSSSHGQHGSGSSYSYSRGHYESGSGQTSGFGQHESGSGQSSGY
    • Sequence Length

    • 67
    • Sequence Name

    • Sequence 101 from Patent US 20200115426
    • Source

    • Synthetic construct
    • Activity

    • Antimicrobial, Antibacterial
    • Patent Type

    • Patent Application
    • Publication Date

    • 2020-4-16
    • Patent Title

    • Cationic Intrinsically Disordered Antimicrobial Peptides
    • Abstract

    • The present invention generally relates to the field of antimicrobial peptides (AMPs), and more specifically to cationic intrinsically disordered antimicrobial peptides (CIDAMPs) and their use as disinfectants and therapeutic agents for the treatment of infections, especially as a therapeutic alternative for the treatment of infectious diseases caused by antibiotic resistant microorganisms.