-
-
Sequence
- CKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFAC
-
-
Sequence Name
- aa 128-167; partial loop-4+loop-5+loop-
-
-
Activity
- Antimicrobial, Anticancer
-
-
Patent Type
- Patent Application
-
Publication Date
- 2002-7-4
-
-
Patent Title
- Novel antiangiogenic peptides
-
Abstract
- The present invention provides an antiangiogenic polypeptide having the amino acid sequence set forth in SEQ ID NO: 1 or a portion thereof which is effective to inhibit endothelial cell proliferation as determined by the capillary EC proliferation assay. Preferably, the portion has at least 50% inhibition of bFGF-stimulated EC proliferation at 5 Tg/ml, more preferably 75% inhibition, most preferably 95% inhibition.