Patent Information

    • DRAMP ID

    • DRAMP36046

    • Sequence

    • CKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSC

    • Sequence Length

    • 48

    • Sequence Name

    • AA 128-175; loop-4+loop-5+loop-6

    • Source

    • Synthetic

    • Activity

    • Antimicrobial, Anticancer

    • Patent Type

    • Patent Application

    • Publication Date

    • 2002-7-4

    • Patent Title

    • Novel antiangiogenic peptides

    • Abstract

    • The present invention provides an antiangiogenic polypeptide having the amino acid sequence set forth in SEQ ID NO: 1 or a portion thereof which is effective to inhibit endothelial cell proliferation as determined by the capillary EC proliferation assay. Preferably, the portion has at least 50% inhibition of bFGF-stimulated EC proliferation at 5 Tg/ml, more preferably 75% inhibition, most preferably 95% inhibition.