• DRAMP ID

    • DRAMP00005
    • Peptide Name

    • Epicidin 280 (Bacteriocin)
    • Source

    • Staphylococcus epidermidis BN 280 (Gram-positive bacteria)
    • Family

    • Belongs to the lantibiotic family (Class I bacteriocin)
    • Gene

    • eciA
    • Sequence

    • SLGPAIKATRQVCPKATRFVTVSCKKSDCQ
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus simulans 22MIC=0.304 μg/ml
        Staphylococcus epidermidis 5MIC=3.85 μg/ml
        Micrococcus luteus ATCC4698MIC=9.7 μg/ml
        Staphylococcus carnosus TM300MIC=0.175 μg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic (very possibly)
    • N-terminal Modification

    • Oxypropionylation
    • C-terminal Modification

    • Not metioned clearly
    • Nonterminal Modifications and Unusual Amino Acids

    • There are possible lanthionine(Lan)/3-methyllanthionine(Me-Lan) structure association between Thr9 and Cys13, Thr21 and Cys24, Ser23 and Cys29.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C137H236N42O41S3
    • Absent Amino Acids

    • EHMNWY
    • Common Amino Acids

    • K
    • Mass

    • 3223.82
    • PI

    • 9.75
    • Basic Residues

    • 6
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +5
    • Boman Index

    • -54.6
    • Hydrophobicity

    • -0.22
    • Aliphatic Index

    • 65
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 4.31
    • Polar Residues

    • 10

DRAMP00005

    • Function

    • Lanthionine-containing peptide antibiotic (lantibiotic) Transiently and partially depolarizes the transmembrane electrical potential and pH gradient of susceptible cells, inhibits the uptake of amino acids and depletes the intracellular ATP pool.
    • PTM

    • Maturation of lantibiotics involves the enzymic conversion of Thr, and Ser into dehydrated AA and the formation of thioether bonds with cysteine. This is followed by membrane translocation and cleavage of the modified precursor.
  • ·Literature 1
    • Title

    • Isolation, characterization, and heterologous expression of the novel lantibiotic epicidin 280 and analysis of its biosynthetic gene cluster.
    • Reference

    • Appl Environ Microbiol. 1998 Sep;64(9):3140-3146.
    • Author

    • Heidrich C, Pag U, Josten M, Metzger J, Jack RW, Bierbaum G, Jung G, Sahl HG.