General Information

    • DRAMP ID

    • DRAMP00071

    • Peptide Name

    • Ubericin-A (Bacteriocin)

    • Source

    • Streptococcus uberis (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • ubaA

    • Sequence

    • KTVNYGNGLYCNQKKCWVNWSETATTIVNNSIMNGLTGGNAGWHSGGRA

    • Sequence Length

    • 49

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Listeria spp., Enterococcus hirae, Enterococcus faecalis ATCC 19433, Streptococcus bovis 83, Streptococcus uberis 42 and Lactococcus lactis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00071 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C227H347N69O71S3

    • Absent Amino Acids

    • DFP

    • Common Amino Acids

    • GN

    • Mass

    • 5274.85

    • PI

    • 9.24

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +4

    • Boman Index

    • -68.38

    • Hydrophobicity

    • -0.557

    • Aliphatic Index

    • 55.71

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 19605

    • Absorbance 280nm

    • 408.44

    • Polar Residues

    • 28

DRAMP00071

DRAMP00071 chydropathy plot

Comments Information

    • Heat-stable antibiotic

Literature Information

  • ·Literature 1

    • Title

    • Ubericin A, a class IIa bacteriocin produced by Streptococcus uberis.

    • Reference

    • Appl Environ Microbiol. 2007 Dec;73(23):7763-7766.

    • Author

    • Heng NC, Burtenshaw GA, Jack RW, Tagg JR.