• DRAMP ID

    • DRAMP00071
    • Peptide Name

    • Ubericin-A (Bacteriocin)
    • Source

    • Streptococcus uberis (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • ubaA
    • Sequence

    • KTVNYGNGLYCNQKKCWVNWSETATTIVNNSIMNGLTGGNAGWHSGGRA
    • Sequence Length

    • 49
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Anti-Gram+, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Listeria spp., Enterococcus hirae, Enterococcus faecalis ATCC 19433, Streptococcus bovis 83, Streptococcus uberis 42 and Lactococcus lactis.
    • Hemolytic Activity

      • Not found
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Formula

    • C227H347N69O71S3
    • Absent Amino Acids

    • DFP
    • Common Amino Acids

    • GN
    • Mass

    • 6131.21
    • PI

    • 9.35
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 13
    • Boman Index

    • -68.38
    • Hydrophobicity

    • -0.557
    • Aliphatic Index

    • 55.71
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 19605
    • Absorbance 280nm

    • 408.44
    • Polar Residues

    • 28

DRAMP00071

DRAMP00071 chydropathy plot
    • Heat-stable antibiotic

  • ·Literature 1
    • Title

    • Ubericin A, a class IIa bacteriocin produced by Streptococcus uberis.
    • Reference

    • Appl Environ Microbiol. 2007 Dec;73(23):7763-7766.
    • Author

    • Heng NC, Burtenshaw GA, Jack RW, Tagg JR.