General Information

    • DRAMP ID

    • DRAMP00090

    • Peptide Name

    • Carnobacteriocin B2 (CbnB2; Bacteriocin)

    • Source

    • Carnobacterium piscicola LV18B (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • cbnB2

    • Sequence

    • VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • [Ref.8163526]Gram-positive bacteria: Lactobacillus plantarum ATCC 4008 (MIC=2 AU/μg), Pediococcus parvulus ATCC 19371 (MIC=8 AU/μg), Listeria monocytogenes ATCC 15313 (MIC=32 AU/μg), Listeria innocua ATCC 33090 (MIC=16 AU/μg), Enterococcus faecium ATCC 11576 (MIC=16 AU/μg), Enterococcus faecalis ATCC 19433 (MIC=16 AU/μg), Enterococcus faecium ATCC 19434 (MIC=4 AU/μg).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • [Ref.8163526 & Ref.10569926] CbnB2 can easily form a disulfide bond between Cys9 and Cys14

    • Stereochemistry

    • L

    • Structure

    • Alpha helix (1 helices; 24 residues)

    • Structure Description

    • CbnB2 forms a disulfide bond and that this peptide has full antimicrobial activity. NMR results indicate that CbnB2 in TFE has a well-defined central helical structure (residues 18-39) but a disordered N terminus. And the central helical structure is conserved.

    • Helical Wheel Diagram

    • DRAMP00090 helical wheel diagram

    • PDB ID

    • 1CW5 resolved by NMR.
  • 1CW5-> 

    • Predicted Structure

Physicochemical Information

    • Formula

    • C213H332N66O68S2

    • Absent Amino Acids

    • DHLM

    • Common Amino Acids

    • G

    • Mass

    • 4969.5

    • PI

    • 9.7

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -73.88

    • Hydrophobicity

    • -0.277

    • Aliphatic Index

    • 54.79

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8605

    • Absorbance 280nm

    • 183.09

    • Polar Residues

    • 25

DRAMP00090

DRAMP00090 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against Listeria and Enterococcus.

    • PTM

    • Contains one disulfide bond 9-14.

Literature Information

  • ·Literature 1

    • Title

    • Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV18B.

    • Reference

    • J Biol Chem 1994; 269: 12204-12211.

    • Author

    • Quadri LE et al Stiles ME.
  • ·Literature 2

    • Title

    • Characteristics and genetic determinants of bacteriocin activities produced by Carnobacterium piscicola CP5 isolated from cheese.

    • Reference

    • Curr Microbiol. 1997 Dec;35(6):319-326.

    • Author

    • Herbin S, Mathieu F, Brul© F, Branlant C, Lefebvre G, Lebrihi A.
  • ·Literature 3

    • Title

    • Solution structure of carnobacteriocin B2 and implications for structure-activity relationships among type IIa bacteriocins from lactic acid bacteria.

    • Reference

    • Biochemistry. 1999 Nov 23;38(47):15438-15447.

    • Author

    • Wang Y, Henz ME, Gallagher NL, Chai S, Gibbs AC, Yan LZ, Stiles ME, Wishart DS, Vederas JC.