General Information

    • DRAMP ID

    • DRAMP00094

    • Peptide Name

    • Bacteriocin SRCAM 1580

    • Source

    • Bacillus circulans (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • VNYGNGVSCSKTKCSVNWGIITHQAFRVTSGVASG

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Clostridium jejuni.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00094 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00094.

Physicochemical Information

    • Formula

    • C156H247N47O49S2

    • Absent Amino Acids

    • DELMP

    • Common Amino Acids

    • GSV

    • Mass

    • 3629.08

    • PI

    • 9.39

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -34.76

    • Hydrophobicity

    • 0.046

    • Aliphatic Index

    • 69.43

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 209.26

    • Polar Residues

    • 19

DRAMP00094

DRAMP00094 chydropathy plot

Comments Information

    • Function

    • Bacteriocin with antibacterial activity.

    • Biophysicochemical properties

    • pH dependence (Stable from pH 3.0-9.0, inactivated at pH 10.0); Temperature dependence (Thermostable, activity is retained after incubation at 100 degrees Celsius for 15 minutes).

    • Miscellaneous

    • Antimicrobial activity is lost upon treatment with beta-chymotrypsin, proteinase K and papain, but not when treated with lysozyme or lipase.

Literature Information

  • ·Literature 1

    • Title

    • Isolation of Bacillus circulans and Paenibacillus polymyxa strains inhibitory to Campylobacter jejuni and characterization of associated bacteriocins.

    • Reference

    • J Food Prot. 2005 Jan;68(1):11-17.

    • Author

    • Svetoch EA, Stern NJ, Eruslanov BV, Kovalev YN, Volodina LI, Perelygin VV, Mitsevich EV, Mitsevich IP, Pokhilenko VD, Borzenkov VN, Levchuk VP, Svetoch OE, Kudriavtseva TY.
  • ·Literature 2

    • Title

    • Bacteriocins reduce Campylobacter colonization and alter gut morphology in turkey poults.

    • Reference

    • Poult Sci. 2006 Sep;85(9):1570-1575.

    • Author

    • Cole K, Farnell MB, Donoghue AM, Stern NJ, Svetoch EA, Eruslanov BN, Volodina LI, Kovalev YN, Perelygin VV, Mitsevich EV, Mitsevich IP, Levchuk VP, Pokhilenko VD, Borzenkov VN, Svetoch OE, Kudryavtseva TY, Reyes-Herrera I, Blore PJ, Solis de los Santos F, Donoghue DJ.