General Information

    • DRAMP ID

    • DRAMP00105

    • Peptide Name

    • Enterocin X alpha (Two-peptide bacteriocin)

    • Source

    • Enterococcus faecium KU-B5 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • enxA

    • Sequence

    • SNDSLWYGVGQFMGKQANCITNHPVKHMIIPGYCLSKILG

    • Sequence Length

    • 40

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis JCM 5803 (MIC=50.8 nM), Enterococcus faecalis OU510 (MIC=102 nM), Enterococcus faecium TUA 1344L (MIC=50.8 nM), Enterococcus hirae ATCC 10541 (MIC=50.8 nM), Lactobacillus plantarum ATCC 14917 (MIC=102 nM), Lactobacillus sakeii ssp.sakei JCM 1157 (MIC=50.8 nM), Lactococcus lactis ssp.cremoris ATCC 19257 (MIC=813 nM), Listeria innocua ATCC 33090 (MIC=25.4 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00105 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00105.

Physicochemical Information

    • Formula

    • C198H307N53O54S4

    • Absent Amino Acids

    • ER

    • Common Amino Acids

    • G

    • Mass

    • 4422.18

    • PI

    • 8.77

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -17.14

    • Hydrophobicity

    • 0.008

    • Aliphatic Index

    • 85.25

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8605

    • Absorbance 280nm

    • 220.64

    • Polar Residues

    • 16

DRAMP00105

DRAMP00105 chydropathy plot

Comments Information

    • Function

    • EntXalpha and EntXbeta encode a double-glycine-type prepeptide with an 18-residue leader sequence, representing the typical structure of class II bacteriocin prepeptides. When combined, Xalpha and Xbeta display variably enhanced or reduced antibacterial activity toward a panel of indicators compared to each peptide individually.

Literature Information

  • ·Literature 1

    • Title

    • Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.

    • Reference

    • Appl Environ Microbiol. 2010 Jul;76(13):4542-4545.

    • Author

    • Hu CB, Malaphan W, Zendo T, Nakayama J, Sonomoto K.