• • DRAMP ID

  • DRAMP00105

• • Peptide Name

  • Enterocin X alpha (Two-peptide bacteriocin)

• • Source

  • Enterococcus faecium KU-B5 (Gram-positive bacteria)

• • Family

  • Belongs to the class IIa bacteriocin

• • Gene

  • enxA

• • Sequence

  • SNDSLWYGVGQFMGKQANCITNHPVKHMIIPGYCLSKILG

• • Sequence Length

  • 40

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)O)[C@H](C)CC)C(C)C)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CO)[C@H](C)CC)[C@H](C)CC)C(=O)NCC(=O)O

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • Gram-positive bacteria:

      Target Organism	Activity
      Enterococcus faecalis JCM 5803	MIC=50.8 nM
      Enterococcus faecalis OU510	MIC=102 nM
      Enterococcus faecium TUA 1344L	MIC=50.8 nM
      Enterococcus hirae ATCC 10541	MIC=50.8 nM
      Lactobacillus plantarum ATCC 14917	MIC=102 nM
      Lactobacillus sakeii ssp.sakei JCM 1157	MIC=50.8 nM
      Lactococcus lactis ssp.cremoris ATCC 19257	MIC=813 nM
      Listeria innocua ATCC 33090	MIC=25.4 nM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

• Predicted Structure

• There is no predicted structure for DRAMP00105.

DRAMP00105

• • Function

  • EntXalpha and EntXbeta encode a double-glycine-type prepeptide with an 18-residue leader sequence, representing the typical structure of class II bacteriocin prepeptides. When combined, Xalpha and Xbeta display variably enhanced or reduced antibacterial activity toward a panel of indicators compared to each peptide individually.

• ·Literature 1

• • Title

  • Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.

• • Pubmed ID

  • 20418437

• • Reference

  • Appl Environ Microbiol. 2010 Jul;76(13):4542-4545.

• • Author

  • Hu CB, Malaphan W, Zendo T, Nakayama J, Sonomoto K.