General Information

    • DRAMP ID

    • DRAMP00106

    • Peptide Name

    • Enterocin X beta (Two-peptide bacteriocin)

    • Source

    • Enterococcus faecium KU-B5 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • enxB

    • Sequence

    • IAPIIVAGLGYLVKDAWDHSDQIISGFKKGWNGGRRK

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis JCM 5803 (MIC=813 nM), Enterococcus faecalis OU510 (MIC=813 nM), E. faecium TUA 1344L (MIC=813 nM), Enterococcus hirae ATCC 10541 (MIC=406 nM), Lactobacillus plantarum ATCC 14917 (MIC=813 nM), Lactobacillus sakeii ssp.sakei JCM 1157 (MIC=102 nM), Bacillus circulans JCM 2504 (MIC=3250 nM), Bacillus coagulans JCM 2257 (MIC=3250 nM), Bacillus subtilis JCM 1465 (MIC=3250 nM), Listeria innocua ATCC 33090 (MIC=3250 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00106 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00106.

Physicochemical Information

    • Formula

    • C187H293N53O49

    • Absent Amino Acids

    • CEMT

    • Common Amino Acids

    • G

    • Mass

    • 4067.71

    • PI

    • 9.82

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -40.75

    • Hydrophobicity

    • -0.197

    • Aliphatic Index

    • 97.57

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 346.94

    • Polar Residues

    • 10

DRAMP00106

DRAMP00106 chydropathy plot

Comments Information

    • Function

    • EntXalpha and EntXbeta encode a double-glycine-type prepeptide with an 18-residue leader sequence, representing the typical structure of class II bacteriocin prepeptides. When combined, Xalpha and Xbeta display variably enhanced or reduced antibacterial activity toward a panel of indicators compared to each peptide individually.

Literature Information

  • ·Literature 1

    • Title

    • Enterocin X, a novel two-peptide bacteriocin from Enterococcus faecium KU-B5, has an antibacterial spectrum entirely different from those of its component peptides.

    • Reference

    • Appl Environ Microbiol. 2010 Jul;76(13):4542-4545.

    • Author

    • Hu CB, Malaphan W, Zendo T, Nakayama J, Sonomoto K.