• • DRAMP ID

  • DRAMP00254

• • Peptide Name

  • Propionicin-F (Bacteriocin)

• • Source

  • Propionibacterium freudenreichii subsp. Freudenreichii LMGT 2946 (Gram-positive bacteria)

• • Family

  • Not found

• • Gene

  • pcfA

• • Sequence

  • WFYQGMNIAIYANIGGVANIIGYTEAAVATLLGAVVAVAPVVP

• • Sequence Length

  • 43

• • UniProt Entry

  • Q6E3K9

• • Protein Existence

  • Protein level

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)[C@H](C)CC)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)O)C(C)C)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)O)C(C)C)C(C)C)C(C)C)[C@@H](C)O)C(C)C)[C@@H](C)O)[C@H](C)CC)[C@H](C)CC)C(C)C)[C@H](C)CC

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+

• • Target Organism

  • • Gram-positive bacteria:

      Target Organism	Activity
      Propionibacterium freudenreichii ssp. freudenreichii ATCC 6207T	MIC=0.7 nM
      P. freudenreichii ssp.shermanii ATCC 9614T	MIC=5.0 nM
      P. freudenreichii ATCC 9616	MIC=20 nM
      P. freudenreichii IFO12426	MIC=2.5 nM
      P. freudenreichii LMGT 2842	MIC=5.0 nM
      P. freudenreichii LMGT 3001	MIC=5.0 nM
      P. freudenreichii LMGT 2946	-
      P. freudenreichii LMGT 2956	-
      P. freudenreichii ISU-P24	MIC=0.7 nM
      P. freudenreichii ISU-P59	MIC=2.5 nM
      P. freudenreichii ISU-P83	MIC=5.0 nM
      P. freudenreichii ISU-P98	MIC=1.3 nM
      P. freudenreichii ISU-P104	MIC=0.2 nM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

• Predicted Structure

• There is no predicted structure for DRAMP00254.

DRAMP00254

• • Function

  • Bacteriocin with specific antibacterial activity.

• ·Literature 1

• • Title

  • Molecular and genetic characterization of propionicin F, a bacteriocin from Propionibacterium freudenreichii.

• • Pubmed ID

  • 15574930

• • Reference

  • Appl Environ Microbiol. 2004 Dec;70(12):7303-7310.

• • Author

  • Brede DA, Faye T, Johnsborg O, Odeg¥rd I, Nes IF, Holo H.