• DRAMP ID

    • DRAMP00275
    • Peptide Name

    • Snakin-1 (StSN1; Cys-rich; Plant defensin)
    • Source

    • Solanum tuberosum (potato)
    • Family

    • Unknow
    • Gene

    • SN1
    • Sequence

    • GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP
    • Sequence Length

    • 63
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Antifungal
    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes (MIC=10 µg/mL), Listeria innocua (MIC=10 µg/mL), Listeria ivanovii (MIC=10 µg/mL), Clavibacter michiganensis (EC50=1 µM), Ralstonia solanacearum (rfa-) (EC50=30 µM), Rhizobium meliloti (EC50=8 µM).
      • Fungi: Botrytis cinerea (EC50=2 µM), Fusarium solani (EC50=3 µM), Fusarium culmorum (EC50=2 µM), Fusarium oxysporum f. sp. conglutinans (EC50=10 µM), Fusarium oxysporum f. sp. lycopersici (EC50=20 µM), Plectosphaerella cucumerina (EC50=10 µM), Colletotrichum graminicola (EC50=10 µM), Colletotrichum lagenarium (EC50=10 µM), Bipolaris maydis (EC50=20 µM), Aspergillus flavus (EC50=20 µM).
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00275 helical wheel diagram
    • Formula

    • C284H465N87O89S12
    • Absent Amino Acids

    • MQW
    • Common Amino Acids

    • CK
    • Mass

    • 8013.14
    • PI

    • 8.69
    • Basic Residues

    • 15
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 8
    • Boman Index

    • -145.81
    • Hydrophobicity

    • -76.98
    • Aliphatic Index

    • 32.54
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5220
    • Absorbance 280nm

    • 84.19
    • Polar Residues

    • 31
browser doesn't support html5

Amino Acid Distribution

DRAMP00275 chydropathy plot
    • Function

    • Has an antimicrobial activity. Causes a rapid aggregation of both Gram-positive and Gram-negative bacteria, but the antimicrobial activity is not correlated with the capacity to aggregate bacteria.
    • Tissue specificity

    • Expressed in tubers, stems, axillary and young floral buds, sepals, petals, stamens and carpels, but not in roots, stolons, shoot apex meristem or young leaves.
    • Induction

    • No responses to methyl jasmonate, ethylene, abscisic acid, salicylic acid, isonicotinic acid, indolacetic acid, gibberellic acid and infection with incompatible bacterial or compatible fungual pathogens.
    • PTM

    • Six disulfide bonds may be present.
  • Literature 1
    • Reference

    • Plant Physiol. 2002 Mar;128(3):951-961.
    • Author

    • Berrocal-Lobo M, Segura A, Moreno M, L³pez G, Garc­a-Olmedo F, Molina A.
    • Title

    • Snakin-2, an antimicrobial peptide from potato whose gene is locally induced by wounding and responds to pathogen infection.
  • Literature 2
    • Reference

    • Mol Plant Microbe Interact. 1999 Jan;12(1):16-23.
    • Author

    • Segura A, Moreno M, Madue±o F, Molina A, Garc­a-Olmedo F.
    • Title

    • Snakin-1, a peptide from potato that is active against plant pathogens.