General Information

    • DRAMP ID

    • DRAMP00275

    • Peptide Name

    • Snakin-1 (StSN1; Cys-rich; Plant defensin)

    • Source

    • Solanum tuberosum (potato)

    • Family

    • Not found

    • Gene

    • SN1

    • Sequence

    • GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP

    • Sequence Length

    • 63

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • [Ref.9885189] Gram-positive bacteria: Listeria monocytogenes (MIC=10 µg/mL), Listeria innocua (MIC=10 µg/mL), Listeria ivanovii (MIC=10 µg/mL), Clavibacter michiganensis (EC50=1 µM), Ralstonia solanacearum (rfa-) (EC50=30 µM), Rhizobium meliloti (EC50=8 µM).
      • Fungi: Botrytis cinerea (EC50=2 µM), Fusarium solani (EC50=3 µM), Fusarium culmorum (EC50=2 µM), Fusarium oxysporum f. sp. conglutinans (EC50=10 µM), Fusarium oxysporum f. sp. lycopersici (EC50=20 µM), Plectosphaerella cucumerina (EC50=10 µM), Colletotrichum graminicola (EC50=10 µM), Colletotrichum lagenarium (EC50=10 µM), Bipolaris maydis (EC50=20 µM), Aspergillus flavus (EC50=20 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • [Ref.9885189] Six disulfide bonds may be present

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00275 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00275.

Physicochemical Information

    • Formula

    • C284H465N87O89S12

    • Absent Amino Acids

    • MQW

    • Common Amino Acids

    • CK

    • Mass

    • 6907.07

    • PI

    • 8.97

    • Basic Residues

    • 15

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +9

    • Boman Index

    • -145.81

    • Hydrophobicity

    • -0.77

    • Aliphatic Index

    • 32.54

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5220

    • Absorbance 280nm

    • 84.19

    • Polar Residues

    • 31

DRAMP00275

DRAMP00275 chydropathy plot

Comments Information

    • Function

    • Has an antimicrobial activity. Causes a rapid aggregation of both Gram-positive and Gram-negative bacteria, but the antimicrobial activity is not correlated with the capacity to aggregate bacteria.

    • Tissue specificity

    • Expressed in tubers, stems, axillary and young floral buds, sepals, petals, stamens and carpels, but not in roots, stolons, shoot apex meristem or young leaves.

    • Induction

    • No responses to methyl jasmonate, ethylene, abscisic acid, salicylic acid, isonicotinic acid, indolacetic acid, gibberellic acid and infection with incompatible bacterial or compatible fungual pathogens.

    • PTM

    • Six disulfide bonds may be present.

Literature Information

  • ·Literature 1

    • Title

    • Snakin-2, an antimicrobial peptide from potato whose gene is locally induced by wounding and responds to pathogen infection.

    • Reference

    • Plant Physiol. 2002 Mar;128(3):951-961.

    • Author

    • Marta Berrocal-Lobo, Ana Segura, Manuel Moreno, Gemma López, Francisco García-Olmedo, Antonio Molina
  • ·Literature 2

    • Title

    • Snakin-1, a peptide from potato that is active against plant pathogens.

    • Reference

    • Mol Plant Microbe Interact. 1999 Jan;12(1):16-23.

    • Author

    • A Segura, M Moreno, F Madueño, A Molina, F García-Olmedo