General Information

    • DRAMP ID

    • DRAMP00309

    • Peptide Name

    • Endochitinase 2 (CHIT 2; Plant defensin)

    • Source

    • Arachis hypogaea (Peanut)

    • Family

    • Belongs to the glycosyl hydrolase 25 family (Chitinase class I subfamily)

    • Gene

    • Not found

    • Sequence

    • MTEQKPKPSCHNVMVGNYVPTASDRAANRTLGFGLVTNIINGGLDC

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00309 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00309.

Physicochemical Information

    • Formula

    • C208H338N62O66S4

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • GN

    • Mass

    • 4891.59

    • PI

    • 7.82

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +2

    • Boman Index

    • -64.68

    • Hydrophobicity

    • -0.213

    • Aliphatic Index

    • 74.13

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 35.89

    • Polar Residues

    • 19

DRAMP00309

DRAMP00309 chydropathy plot

Comments Information

    • Function

    • Defense against chitin containing fungal and bacterial pathogens.

    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.

    • Induction

    • By glucan and Phytophthora megasperma elicitors.

Literature Information

  • ·Literature 1

    • Title

    • Elicitor-specific induction of one member of the chitinase gene family in Arachis hypogaea.

    • Reference

    • Mol Gen Genet. 1990 Dec;224(3):469-476.

    • Author

    • Herget T, Schell J, Schreier PH.