• DRAMP ID

    • DRAMP00309
    • Peptide Name

    • Endochitinase 2 (CHIT 2; Plant defensin)
    • Source

    • Arachis hypogaea (Peanut)
    • Family

    • Belongs to the glycosyl hydrolase 25 family (Chitinase class I subfamily)
    • Gene

    • N/A
    • Sequence

    • MTEQKPKPSCHNVMVGNYVPTASDRAANRTLGFGLVTNIINGGLDC
    • Sequence Length

    • 46
    • Evidence code

    • Transcript level
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

    • Binding Target

    • N/A
    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP00309 helical wheel diagram
    • Formula

    • C208H338N62O66S4
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • GN
    • Mass

    • 5694.44
    • PI

    • 8.23
    • Basic Residues

    • 5
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 13
    • Boman Index

    • -64.68
    • Hydrophobicity

    • -21.3
    • Aliphatic Index

    • 74.13
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 35.89
    • Polar Residues

    • 19

DRAMP00309

DRAMP00309 chydropathy plot
    • Function

    • Defense against chitin containing fungal and bacterial pathogens.
    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.
    • Induction

    • By glucan and Phytophthora megasperma elicitors.
  • Literature 1
    • Reference

    • Mol Gen Genet. 1990 Dec;224(3):469-476.
    • Author

    • Herget T, Schell J, Schreier PH.
    • Title

    • Elicitor-specific induction of one member of the chitinase gene family in Arachis hypogaea.