General Information

    • DRAMP ID

    • DRAMP00415

    • Peptide Name

    • Raphanus sativus Antifungal Protein 2 (Rs-AFP2; Plant defensin)

    • Source

    • Raphanus sativus (Radish)

    • Family

    • Belongs to the DEFL family

    • Gene

    • AFP2

    • Sequence

    • QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 51

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicola (IC50=2 µg/ml), Ascochyta pisi (IC50=4 µg/ml), Botrytis cinerea (IC50=2 µg/ml), Cercospora beticola (IC50=2 µg/ml), Colletotrichum lindemuthianum (IC50=3 µg/ml), Fusarium culmorum (IC50=2 µg/ml), Fusarium oxysporum f.sp.lycopersici (IC50=2 µg/ml), Fusarium oxysporum f.sp.pisi (IC50=2 µg/ml), Mycosphaerella fijiensis var.fijiensis (IC50=1.5 µg/ml), Nectria haematococca (IC50=2 µg/ml), Phoma betae (IC50=1 µg/ml), Phytophthora infestans (IC50=25 µg/ml), Pyrenophora tritici-repentis (IC50=1.5 µg/ml), Pyricularia oryzae (IC50=0.4 µg/ml), Rhizoctonia solani (IC50>100 µg/ml), Sclerotinia sclerotiorum (IC50>100 µg/ml), Septoria nodorum (IC50=15 µg/ml), Trichoderma hamatum (IC50=2 µg/ml), Verticillium dahliae (IC50=1.5 µg/ml), Venturia inaequalis (IC50=25 µg/ml). [NOTE: Synthetic low ionic strength growth medium]

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00415 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00415.

Physicochemical Information

    • Formula

    • C244H379N77O68S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5735.65

    • PI

    • 9.08

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +8

    • Boman Index

    • -90.48

    • Hydrophobicity

    • -0.471

    • Aliphatic Index

    • 47.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 179.6

    • Polar Residues

    • 23

DRAMP00415

DRAMP00415 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 4-51;15-36;21-45;25-47, and Pyrrolidone carboxylic acid at position 1.

Literature Information

  • ·Literature 1

    • Title

    • Small cysteine-rich antifungal proteins from radish: their role in host defense.

    • Reference

    • Plant Cell. 1995 May;7(5):573-588.

    • Author

    • Terras FR, Eggermont K, Kovaleva V, Raikhel NV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuven F, Vanderleyden J, et al.