• DRAMP ID

    • DRAMP00423
    • Peptide Name

    • Defensin-like protein 2 (Sa-AFP2; Plant defensin)
    • Source

    • Sinapis alba (White mustard) (Brassica hirta)
    • Family

    • Unknow
    • Gene

    • Unknow
    • Sequence

    • KLCQRPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
    • Sequence Length

    • 50
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknow
    • Biological Activity

    • Antifungal
    • Target Organism

      • Fungi: Alternaria brassicola (MIC=4.5 µg/ml), Botrytis cinerea (MIC=3.5 µg/ml), Fusarium culmorum (MIC=2.3 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=2.3 µg/ml), Pyricularia oryzae (MIC=0.3 µg/ml), Verticillium dahliae (MIC=1.2 µg/ml).
      • NOTE: In synthetic low ionic strength fungal growth medium.
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP00423 helical wheel diagram
    • Formula

    • C237H365N73O67S8
    • Absent Amino Acids

    • DM
    • Common Amino Acids

    • C
    • Mass

    • 6439.64
    • PI

    • 8.59
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -76.66
    • Hydrophobicity

    • -39
    • Aliphatic Index

    • 48.8
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 183.27
    • Polar Residues

    • 24

Amino Acid Distribution

DRAMP00423 chydropathy plot
    • Function

    • Possesses antifungal activity sensitive to inorganic cations.
  • Literature 1
    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.
    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.
    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.