• • DRAMP ID

  • DRAMP00441

• • Peptide Name

  • Defensin Tk-AMP-D1 (Plant defensin)

• • Source

  • Triticum kiharae (Wheat)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Not found

• • Sequence

  • RTCQSQSHKFKGACFSDTNCDSVCRTENFPRGQCNQHHVERKCYCERDC

• • Sequence Length

  • 49

• • UniProt Entry

  • P84963

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antifungal

• • Target Organism

  • • Fungi: Fusarium graminearum and Fusarium verticillioides (MIC<30 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Bridge

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00441.

DRAMP00441

• • Function

  • Has weak antifungal activity, but not against A. consortiale Botrytis cinerea, H. sativum, F. culmorum, C. graminicola and D. maydis.

• • PTM

  • Contains four disulfide bonds 3-49; 14-34; 20-43; 24-45 (By similarity).

• ·Literature 1

• • Title

  • Seed defensins from T. kiharae and related species: genome localization of defensin-encoding genes.

• • Pubmed ID

  • 17321030

• • Reference

  • Biochimie. 2007 May;89(5):605-612.

• • Author

  • Odintsova TI, Egorov TA, Musolyamov AKh, Odintsova MS, Pukhalsky VA, Grishin EV.

• ·Literature 2

• • Title

  • Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv.

• • Pubmed ID

  • 18625284

• • Reference

  • Biochimie. 2008 Nov-Dec;90(11-12):1667-1673.

• • Author

  • Odintsova TI, Rogozhin EA, Baranov Y, Musolyamov AKh, Yalpani N, Egorov TA, Grishin EV.