• DRAMP ID

    • DRAMP00454
    • Peptide Name

    • Petunia hybrida defensin 1 (PhD1; Cys-rich; Plant defensin)
    • Source

    • Petunia hybrida (Petunia)
    • Family

    • Belongs to the DEFL family
    • Gene

    • D1
    • Sequence

    • ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC
    • Sequence Length

    • 47
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal
    • Target Organism

      • Fungi: Fusarium oxysporum (MIC=10 µg/ml), Botrytis cinerea (MIC=10 µg/ml).
    • Binding Traget

    • Unknow
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • PhD1 has the fold of the cysteine-stabilized alphabeta motif, consisting of an alpha-helix and a triple-stranded antiparallel beta-sheet, except that it contains a fifth disulfide bond from the first loop to the alpha-helix.
    • PDB ID

    • 1N4N resolved by NMR.
    • DRAMP00454 helical wheel diagram
    • 1N4N-> 
    • Formula

    • C217H363N65O63S10
    • Absent Amino Acids

    • MQY
    • Common Amino Acids

    • C
    • Mass

    • 6031.98
    • PI

    • 8.58
    • Basic Residues

    • 11
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -80.46
    • Hydrophobicity

    • -21.06
    • Aliphatic Index

    • 54.04
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6125
    • Absorbance 280nm

    • 133.15
    • Polar Residues

    • 18
browser doesn't support html5

Amino Acid Distribution

DRAMP00454 chydropathy plot
    • Function

    • Plant defense peptide with antifungal activity.
    • Tissue specificity

    • Petals.
    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
    • Biophysicochemical properties

    • pH dependence (Stable under extremes of pH); Temperature dependence (Stable under extremes of temperature).
    • PTM

    • Contains five disulfide bonds 3-47; 7-23; 14-34; 20-41; 24-43.
  • Literature 1
    • Reference

    • Plant Physiol. 2003 Mar;131(3):1283-1293.
    • Author

    • Lay FT, Brugliera F, Anderson MA.
    • Title

    • Isolation and properties of floral defensins from ornamental tobacco and petunia.