General Information

    • DRAMP ID

    • DRAMP00469

    • Peptide Name

    • Defensin-like protein 13 (At-AFP1; Protein LCR67; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PDF1.1

    • Sequence

    • QKLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 51

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicola (IC50=10 µg/ml), Botrytis cinerea (IC50=3.90 µg/ml), Fusarium culmorum (IC50=3 µg/ml), Fusarium oxysporum f.sp. lycopersici (IC50=3 µg/ml), Pyricularia oryzae (IC50=0.25 µg/ml), Verticiliium dahliae (IC50=1.50 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Rich

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00469 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00469.

Physicochemical Information

    • Formula

    • C241H371N73O70S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5667.52

    • PI

    • 8.72

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +6

    • Boman Index

    • -80.23

    • Hydrophobicity

    • -0.398

    • Aliphatic Index

    • 47.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 179.6

    • Polar Residues

    • 24

DRAMP00469

DRAMP00469 chydropathy plot

Comments Information

    • Function

    • Confers broad-spectrum resistance to pathogens. Possesses antifungal activity sensitive to inorganic cations in vitro.

    • Tissue specificity

    • Expressed predominantly in siliques and dry seeds.

    • PTM

    • Contains four disulfide bonds 4-51; 15-36; 21-45; 25-47, and pyrrolidone carboxylic acid at Q1.

Literature Information

  • ·Literature 1

    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.

    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.

    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.
  • ·Literature 2

    • Title

    • Use of a PTGS-MAR expression system for efficient in planta production of bioactive Arabidopsis thaliana plant defensins.

    • Reference

    • Transgenic Res. 2007 Aug;16(4):531-538.

    • Author

    • Sels J, Delaur© SL, Aerts AM, Proost P, Cammue BP, De Bolle MF.
  • ·Literature 3

    • Title

    • Pathogen-induced systemic activation of a plant defensin gene in Arabidopsis follows a salicylic acid-independent pathway.

    • Reference

    • Plant Cell. 1996 Dec;8(12):2309-2323.

    • Author

    • Penninckx IA, Eggermont K, Terras FR, Thomma BP, De Samblanx GW, Buchala A, M©traux JP, Manners JM, Broekaert WF.