• • DRAMP ID

  • DRAMP00751

• • Peptide Name

  • Defensin-2 (Plant defensin)

• • Source

  • Pinus sylvestris (Scots pine)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Def2

• • Sequence

  • RMCKTPSAKFKGYCVSSTNCKNVCRTEGFPTGSCDFHITSRKCYCYKPCP

• • Sequence Length

  • 50

• • UniProt Entry

  • A4L7R8

• • Protein Existence

  • Homology

• • Biological Activity

  • Antimicrobial, Antifungal

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 7LNS

• Predicted Structure

• There is no predicted structure for DRAMP00751.

DRAMP00751

• • Function

  • Plant defense peptide. Has antifungal activity.

• • PTM

  • Contains three disulfide bonds (By similarity).

• ·Literature 1

• • Title

  • Molecular cloning and characterization of Scotch pine Defensin-2.

• • Pubmed ID

  • 19253756

• • Reference

  • Tsitol Genet. 2008 Nov-Dec;42(6):55-60.

• • Author

  • Koval'ova VA, Hut RT.