General Information

    • DRAMP ID

    • DRAMP00785

    • Peptide Name

    • Varv peptide B (Varv B; Plant defensin)

    • Source

    • Viola arvensis (European field pansy) (Field violet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GLPVCGETCFGGTCNTPGCSCDPWPMCSRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Anti-cancer

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys19; Cys9 and Cys21; Cys14 and Cys26.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00785 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00785.

Physicochemical Information

    • Formula

    • C125H190N36O42S7

    • Absent Amino Acids

    • AHIKQY

    • Common Amino Acids

    • C

    • Mass

    • 3093.52

    • PI

    • 4.37

    • Basic Residues

    • 1

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 4

    • Net Charge

    • -1

    • Boman Index

    • -29.24

    • Hydrophobicity

    • -0.127

    • Aliphatic Index

    • 22.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 202.59

    • Polar Residues

    • 18

DRAMP00785

DRAMP00785 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • Contains three disulfide bonds 5-19; 9-21; 14-26.

Literature Information

  • ·Literature 1

    • Title

    • Seven novel macrocyclic polypeptides from Viola arvensis.

    • Reference

    • J Nat Prod. 1999 Feb;62(2):283-286.

    • Author

    • Göransson U, Luijendijk T, Johansson S, Bohlin L, Claeson P.